Product Description
HO-1 Protein is available at Gentaur for Next week delivery.
Description: Rat Natural HO-1 Full Length Protein
Alternative Name(s): Heme oxygenase 1 Protein, HSP32 Protein, Hemox Protein, 32 kD Protein, bK286B10 Protein, D8Wsu38e Protein, heat shock protein 32kD Protein, Heat shock Protein, Heme oxygenase (decycling) 1 Protein, HMOX 1 Protein, Hmox Protein, HMOX1 Protein, HO 1 Protein, HO Protein, HO1 Protein
Research Area(s): Cancer | Oxidative Stress
Nature: Natural
Accession Number: NP_036712.1
Gene ID: 24451
Swiss-Prot: P06762
Applications Species: WB | SDS-PAGE
Biological Activity:
Expression System: Native
Protein Length: Full Length
Amino Acid Sequence: MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
Purification: Ion-exchange Purified
Storage Buffer: 20mM Tris pH7.5, 0.1mM EDTA, 0.1% triton x-100, 0.2% Na cholate, <50mM KCl
Concentration: Lot/batch specific. See included datasheet.
Shipping Temperature: Blue Ice or 4ºC
Other relevant information:
Certificate of Analysis: This product has been certified >90% pure using SDS - PAGE analysis.
Cellular Localization: Microsome | Endoplasmic Reticulum
Scientific Background: Heme-oxygenase is a ubiquitous enzyme that catalyzes the initial and rate-limiting steps in heme catabolism yielding equimolar amounts of biliverdin, iron and carbon monoxide. Biliverdin is subsequently converted to bilirubin and the free iron is sequestered to ferritin (1). These products have important physiological effects as carbon monoxide is a potent vasodilator; biliverdin and bilirubin are potent antioxidants; and the free iron increases oxidative stress and regulates the expression of many mRNAs (2). There are three isoforms of heme-oxygenase, HO-1, HO-2 and HO-3; however HO-1 and HO-2 are the major isoforms as they both have been identified in mammals (3). HO-1, also known as heat shock protein 32, is an inducible isoform activated by most oxidative stress inducers, cytokines, inflammatory agents and heat shock. HO-2 is a constitutive isoform which is expressed under homeostatic conditions. HO-1 is also considered to be a cytoprotective factor in that free heme is highly reactive and cytotoxic, and secondly, carbon monoxide is a mediator inhibiting the inflammatory process and bilirubin is a scavenger for reactive oxygen, both of which are the end products of heme catalyzation (4). It has also been shown that HO-1 deficiency may cause reduced stress defense, a pro-inflammatory tendency (5), susceptibility to atherosclerotic lesion formation (6), endothelial cell injury, and growth retardation (7). Up-regulation of HO-1 is therefore said to be one of the major defense mechanisms of oxidative stress (4).
References: 1. Froh M. et al. (2007) World J. Gastroentereol 13(25): 3478-86. 2. Elbirt K.K. and Bonkovsky H.L. (1999) Proc Assoc Am Physicians 111(5): 348-47. 3. Maines M.D., Trakshel G.M., and Kutty R.K. (1986) J Biol Chem 261: 411–419. 4. Brydun A., et al. (2007) Hypertens Res 30(4): 341-8. 5. Poss K.D. and Tonegawa S. (1997). Proc Natl Acad Sci U S A. 94: 10925–10930. 6. Yet S.F., et al. (2003) FASEB J. 17: 1759–1761. 7. Yachie A., et al. (1999) J Clin Invest. 103: 129–135.
Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
PubMed ID:
Published Application:
Published Species Reactivity:
"
Euro
British Pound
US Dollar