Quick view Details Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU41720 Recombinant Golgi Glycoprotein 1 (GLG1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU52757 Recombinant GM2 Ganglioside Activator (GM2A) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU50503 Recombinant Glypican 5 (GPC5) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU41719 Recombinant Glypican 4 (GPC4) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU51970 Recombinant Glypican 3 (GPC3) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU41715 Recombinant Glypican 1 (GPC1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU41712 Recombinant Glyoxalase I (GLO1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU52204 Recombinant Glycyl tRNA Synthetase (GARS) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU52327 Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU53227 Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU56168 Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU52962 Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU41711 Recombinant Glycoprotein VI (GP6) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU54304 Recombinant Glycoprotein IX, Platelet (GP9) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU54271 Recombinant Glycoprotein A33 (GPA33) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU54105 Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU53479 Recombinant Glycoprotein 130 (gp130) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU51953 Recombinant Glycophorin E (GYPE) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU53405 Recombinant Glycophorin C (GYPC) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU41704 Recombinant Glycophorin A (GYPA) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU52857 Recombinant Glycolipid Transfer Protein (GLTP) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU55837 Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU54048 Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU55968 Recombinant Glycogen Synthase 2, Liver (GYS2) MSRP: Now: £0.00 Compare Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Details Biomatik Proteins | sku: RPU55255 Recombinant Glycogen Phosphorylase, Muscle (PYGM) MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU52953 Recombinant Growth Differentiation Factor 10 (GDF10) Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU41755 Recombinant Growth Differentiation Factor 1 (GDF1) Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU53934 Recombinant Growth Associated Protein 43 (GAP43) Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU53899 Recombinant Growth Arrest Specific Protein 6 (GAS6) Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU41749 Recombinant Growth Arrest Specific Protein 2 (GAS2) Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU53886 Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU53703 Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU54274 Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU51405 Recombinant Gremlin 2 (GREM2) Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU50420 Recombinant Gremlin 1 (GREM1) Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU56095 Recombinant Green Fluorescent Protein (GFP) Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU54548 Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU54127 Recombinant GRB2 Associated Binding Protein 3 (GAB3) Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU54273 Recombinant GRB2 Associated Binding Protein 2 (GAB2) Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU41740 Recombinant GRB2 Associated Binding Protein 1 (GAB1) Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU41738 Recombinant Granzyme M (GZMM) Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU51762 Recombinant Granzyme K (GZMK) Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU52354 Recombinant Granzyme H (GZMH) Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU41734 Recombinant Granzyme D (GZMD) Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU51742 Recombinant Granzyme B (GZMB) Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU54600 Recombinant Granzyme A (GZMA) Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU54615 Recombinant Granulocyte Chemotactic Protein 2 (GCP2) Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU41730 Recombinant Granulin (GRN) Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU52151 Recombinant Grancalcin (GCA) Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPC20767 Recombinant Gossypium hirsutum MML3_A12 (MML3) Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU41726 Recombinant Gonadotropin Releasing Hormone (GnRH) Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;... MSRP: Now: £0.00 Compare Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view
Quick view Biomatik Proteins | sku: RPU41722 Recombinant Golgi Phosphoprotein 2 (GOLPH2) Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379... MSRP: Now: £0.00 Compare Quick view