Recombinant Absidia glauca Actin-1 (ACT1), partial

Product Description

Recombinant Absidia glauca Actin-1 (ACT1), partial is available at Gentaur for Next week Delivery.

Gene Name: ACT1

Alternative Names :

Expression Region : 1-140aa

AA Sequence : MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 21.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.

Function : Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.

Involvement in disease :

Subcellular location : Cytoplasm, cytoskeleton

Protein Families : Actin family

Tissue Specificity :

Paythway :

Uniprot ID : P10982