Product Description
Recombinant Absidia glauca Actin-1 (ACT1), partial is available at Gentaur for Next week Delivery.
Gene Name: ACT1
Alternative Names :
Expression Region : 1-140aa
AA Sequence : MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 21.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
Function : Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
Involvement in disease :
Subcellular location : Cytoplasm, cytoskeleton
Protein Families : Actin family
Tissue Specificity :
Paythway :
Uniprot ID : P10982
Euro
British Pound
US Dollar