Recombinant Anas platyrhynchos Lysozyme C-1

Product Description

Recombinant Anas platyrhynchos Lysozyme C-1 is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : 1,4-beta-N-acetylmuramidase C

Expression Region : 19-147aa

AA Sequence : KVYSRCELAAAMKRLGLDNYRGYSLGNWVCAANYESGFNTQATNRNTDGSTDYGILQINSRWWCDNGKTPRSKNACGIPCSVLLRSDITEAVRCAKRIVSDGDGMNAWVAWRNRCRGTDVSKWIRGCRL

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 30.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.

Function : Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Glycosyl hydrolase 22 family

Tissue Specificity :

Paythway :

Uniprot ID : P00705