Euro
British Pound
US Dollar
Product Description
Recombinant Apomastus schlingeri U1-cyrtautoxin-As1c is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names : Aptotoxin VI Aptotoxin-6 Paralytic peptide VI Short name:PP VI
Expression Region : 1-76aa
AA Sequence : EIPQNLGSGIPHDKIKLPNGQWCKTPGDLCSSSSECCKAKHSNSVTYASFCSRQWSGQQALFINQCRTCNVESSMC
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 12.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Is both paralytic and lethal, when injected into lepidopteran larvae.
Function : Is both paralytic and lethal, when injected into lepidopteran larvae.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Aptotoxin family
Tissue Specificity : Expressed by the venom gland.
Paythway :
Uniprot ID : P49270
