Recombinant Arabidopsis thaliana Chorismate mutase, chloroplastic (CM1), partial

Product Description

Recombinant Arabidopsis thaliana Chorismate mutase, chloroplastic (CM1), partial is available at Gentaur for Next week Delivery.

Gene Name: APX1

Alternative Names : CM-1

Expression Region : 3-247aa

AA Sequence : ASLLMRSSCCSSAIGGFFDHRRELSTSTPISTLLPLPSTKSSFSVRCSLPQPSKPRSGTSSVHAVMTLAGSLTGKKRVDESESLTLEGIRNSLIRQEDSIIFGLLERAKYCYNADTYDPTAFDMDGFNGSLVEYMVKGTEKLHAKVGRFKSPDEHPFFPDDLPEPMLPPLQYPKVLHFAADSININKKIWNMYFRDLVPRLVKKGDDGNYGSTAVCDAICLQCLSKRIHYGKFVAEAKFQASPEA

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 31.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play a role in chloroplast biogenesis.Curated

Function : May play a role in chloroplast biogenesis.

Involvement in disease :

Subcellular location : Plastid, chloroplast

Protein Families :

Tissue Specificity : Expressed in roots, shoots, rosette leaves, stems, cauline leaves, flowers and siliques.

Paythway :

Uniprot ID : P42738