Recombinant Arabidopsis thaliana Cyclin-dependent kinase B1-2 (CDKB1-2)

Product Description

Recombinant Arabidopsis thaliana Cyclin-dependent kinase B1-2 (CDKB1-2) is available at Gentaur for Next week Delivery.

Gene Name: CDKB1-2

Alternative Names : Short name:CDKB1;2

Expression Region : 1-311aa

AA Sequence : MEKYEKLEKVGEGTYGKVYKAMEKTTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSQSIYIVRLLCVEHVIQSKDSTVSHSPKSNLYLVFEYLDTDLKKFIDSHRKGSNPRPLEASLVQRFMFQLFKGVAHCHSHGVLHRDLKPQNLLLDKDKGILKIADLGLSRAFTVPLKAYTHEIVTLWYRAPEVLLGSTHYSTAVDIWSVGCIFAEMIRRQALFPGDSEFQQLLHIFRLLGTPTEQQWPGVMALRDWHVYPKWEPQDLSRAVPSLSPEGIDLLTQMLKYNPAERISAKAALDHPYFDSLDKSQF

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 37.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : ATP + a protein = ADP + a phosphoprotein. ATP + [DNA-directed RNA polymerase] = ADP + [DNA-directed RNA polymerase] phosphate.

Function : Together with CDKB1-1, promotes both the last division in the stomatal cell lineage as well as the number of stomata

Involvement in disease :

Subcellular location :

Protein Families : Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily

Tissue Specificity : Expressed in flowers.

Paythway :

Uniprot ID : Q2V419