Recombinant Arabidopsis thaliana Nucleoside diphosphate kinase 1 (NDK1)

Product Description

Recombinant Arabidopsis thaliana Nucleoside diphosphate kinase 1 (NDK1) is available at Gentaur for Next week Delivery.

Gene Name: NDK1

Alternative Names : Nucleoside diphosphate kinase I Short name:NDK I Short name:NDP kinase I Short name:NDPK I

Expression Region : 1-149aa

AA Sequence : MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYET

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 20.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress.

Function : Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress.

Involvement in disease :

Subcellular location : Peroxisome, Nucleus, Cytoplasm

Protein Families : NDK family

Tissue Specificity :

Paythway :

Uniprot ID : P39207