Euro
British Pound
US Dollar
Product Description
Recombinant Arabidopsis thaliana Putative defensin-like protein 70 (LCR83) is available at Gentaur for Next week Delivery.
Gene Name: LCR83
Alternative Names : Putative low-molecular-weight cysteine-rich protein 83 Short name: Protein LCR83
Expression Region : 28-82aa
AA Sequence : NFASGEASSQLCFNPCTPQLGNNECNTICMNKKYKEGSCVGFGIPPTSKYCCCKT
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal GST-tagged
Theoretical MW : 32.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Secreted
Protein Families : DEFL family
Tissue Specificity :
Paythway :
Uniprot ID : P82792
