Recombinant Bacillus sp. Levanase, partial

Product Description

Recombinant Bacillus sp. Levanase, partial is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : 2,6-beta-D-fructan fructanohydrolase Endo-levanase

Expression Region : 451-579aa

AA Sequence : LPWNDLGHVWSGSAVADTTNASGLFGSSGGKGLIAYYTSYNPDRHNGNQKIGLAYSTDRGRTWKYSEEHPVVIENPGKTGEDPGGWDFRDPKVVRDEANNRWVMVVSGGDHIRLFTSTNLLNWTLTDQF

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 16.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Microbiology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the hydrolysis of levan with endo-type specificity. The products of levan hydrolysis are a mixture of fructose and a series of fructooligosaccharides up to 12-mer, with levantriose being the major oligosaccharide obtained. Is not active towards sucrose.

Function : Catalyzes the hydrolysis of levan with endo-type specificity. The products of levan hydrolysis are a mixture of fructose and a series of fructooligosaccharides up to 12-mer, with levantriose being the major oligosaccharide obtained. Is not active towards sucrose.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Glycosyl hydrolase 32 family

Tissue Specificity :

Paythway :

Uniprot ID : O31411