Recombinant Bacillus subtilis Modification methylase BglII (bglIIM)

Product Description

Recombinant Bacillus subtilis Modification methylase BglII (bglIIM) is available at Gentaur for Next week Delivery.

Gene Name: bglIIM

Alternative Names : N(4)- cytosine-specific methyltransferase BglII

Expression Region : 1-360aa

AA Sequence : MSEDQYKQIKLHLGMEDDNEDLPNHIPSSFPKQHLNKIYNGDTMNMLLDIPDNSVDLVVTSPPYNINKFKNDRRPLEEYLKWQTEIIEQCHRVLKPSGSIFWQVGTYVNDSGAHIPLDIRFFPIFESLGMFPRNRIVWVRPHGLHANKKFAGRHETILWFTKTPEYKFFLDPIRVPQKYANKKHYKGDKKGELSGDPLGKNPGDVWAFRNVRHNHEEDTIHPTQYPEDMIERIVLSTTEPNDIVLDPFIGMGTTASVAKNLNRYFYGAEIEKEYVDIAYQILSGEPDENNNFPNLKTLRQYCEKNGIIDPSQYTFTRQRKGSKPSLDSKAHPEEHHKKEIVERIEFEAENSVYKKVQNEQ

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 58 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This methylase recognizes the double-stranded sequence AGATCT, causes specific methylation on C-5 on both strands, and protects the DNA from cleavage by the BglII endonuclease.

Function : This methylase recognizes the double-stranded sequence AGATCT, causes specific methylation on C-5 on both strands, and protects the DNA from cleavage by the BglII endonuclease.

Involvement in disease :

Subcellular location :

Protein Families : N(4)/N(6)-methyltransferase family, N(4) subfamily

Tissue Specificity :

Paythway :

Uniprot ID : Q45489