Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac (cry1Ac), partial

Product Description

Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac (cry1Ac), partial is available at Gentaur for Next week Delivery.

Gene Name: cry1Ac

Alternative Names : 133KDA crystal protein;Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(c)

Expression Region : 972-1178aa

AA Sequence : LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 25.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

Function : Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

Involvement in disease :

Subcellular location :

Protein Families : Delta endotoxin family

Tissue Specificity :

Paythway :

Uniprot ID : P05068