Recombinant Betula pendula Major pollen allergen Bet v 1-A (BETVIA)

Product Description

Recombinant Betula pendula Major pollen allergen Bet v 1-A (BETVIA) is available at Gentaur for Next week Delivery.

Gene Name: BETVIA

Alternative Names : Allergen Bet v I-A Allergen: Bet v 1-A

Expression Region : 2-160aa

AA Sequence : GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 33.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Allergen

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be a general steroid carrier protein.

Function : May be a general steroid carrier protein.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : BetVI family

Tissue Specificity :

Paythway :

Uniprot ID : P15494