Product Description
Recombinant Blattella germanica Glutathione S-transferase is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names : GST class-sigma Major allergen Bla g 5 Allergen: Bla g 5
Expression Region : 2-204aa
AA Sequence : APSYKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKKETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALREKVLGLPAIKAWVAKRPPTDL
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 25.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Metabolism
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : RX + glutathione = HX + R-S-glutathione.
Function :
Involvement in disease :
Subcellular location :
Protein Families : GST superfamily, Sigma family
Tissue Specificity :
Paythway :
Uniprot ID : O18598
Euro
British Pound
US Dollar