Product Description
Recombinant Bombyx mori Prothoracicotropic hormone is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names :
Expression Region : 116-224aa
AA Sequence : GNIQVENQAIPDPPCTCKYKKEIEDLGENSVPRFIETRNCNKTQQPTCRPPYICKESLYSITILKRRETKSQESLEIPNELKYRWVAESHPVSVACLCTRDYQLRYNNN
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 16.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : PTTH is a brain secretory polypeptide of insects which stimulates the prothoracic glands to produce and release ecdysone, the steroid essential to insect development.Peptides P2K and P6K are presumed to be cleaved post-translationally and may play some unknown physiologically or developmentally important functions.
Function : PTTH is a brain secretory polypeptide of insects which stimulates the prothoracic glands to produce and release ecdysone, the steroid essential to insect development.; FUNCTION
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity : PTTH is synthesized by two dorsolateral neurosecretory cells of the Bombyx brain.
Paythway :
Uniprot ID : P17219
Euro
British Pound
US Dollar