Product Description
Recombinant Borrelia burgdorferi ATP-dependent Clp protease proteolytic subunit 2 (clpP2) is available at Gentaur for Next week Delivery.
Gene Name: clpP2
Alternative Names : Endopeptidase Clp 2
Expression Region : 1-198aa
AA Sequence : MTGKEDNDACVLHDKSLKLVLKSRSIVIAGEITKDVSRLFQEKILLLEALDFKKPIFVYIDSEGGDIDAGFAIFNMIRFVKPKVFTVGVGLVASAAALIFLAAKLENRFSLPFARYLLHQPLSGFKGVATDIEIYTNELNKVKKELNNIISKETGQKISKIEKDTDRDFWLDSSAAKKYGLVFEVVETKYQLEEFISA
Sequence Info : Full Length
Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Theoretical MW : 42.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.
Function : Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : Peptidase S14 family
Tissue Specificity :
Paythway :
Uniprot ID : O51698
Euro
British Pound
US Dollar