Recombinant Bovine Enteropeptidase (TMPRSS15), partial

Product Description

Recombinant Bovine Enteropeptidase (TMPRSS15), partial is available at Gentaur for Next week Delivery.

Gene Name: TMPRSS15

Alternative Names : Enterokinase Serine protease 7 Transmembrane protease serine 15 ENTK, PRSS7

Expression Region : 801-1035

AA Sequence : IVGGSDSREGAWPWVVALYFDDQQVCGASLVSRDWLVSAAHCVYGRNMEPSKWKAVLGLHMASNLTSPQIETRLIDQIVINPHYNKRRKNNDIAMMHLEMKVNYTDYIQPICLPEENQVFPPGRICSIAGWGALIYQGSTADVLQEADVPLLSNEKCQQQMPEYNITENMVCAGYEAGGVDSCQGDSGGPLMCQENNRWLLAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFLH

Sequence Info : Partial

Tag Info : C-terminal 6xHis-tagged

Theoretical MW : 28.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases.

Function : Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases.

Involvement in disease :

Subcellular location : Membrane, Single-pass type II membrane protein

Protein Families : Peptidase S1 family

Tissue Specificity : Intestinal brush border.

Paythway :

Uniprot ID : P98072