Recombinant Bovine Serpin A3-5 (SERPINA3-5)

Product Description

Recombinant Bovine Serpin A3-5 (SERPINA3-5) is available at Gentaur for Next week Delivery.

Gene Name: SERPINA3-5

Alternative Names :

Expression Region : 25-411aa

AA Sequence : LPENVVVKDQRRRVDSHTLASSNTDFAFSLYKQLALKNPNKNVMFSPLSVSMALAFLSLGARGPTLTEILEGLKFNLTEIQETQIHQGFQHLLQALNRPSNQLQLSVGNAMFVQEELKLLDKFIEDARVLYSSEAFPTNFRDSEAARSLINDYVKNKTQGKIEELFKYLSPRTVLVLVNYIYFKAQWKTRFDPKHTEQAEFHVSKNKTVEVPMMTLDLETPYFRDKELGCMLVELTYSSNDSALFILPDEGKMQDLEAKLTPETLTRWRNSLQPRRIHELYLPKFSIKSNYELNDTLSQMGIKKIFTDADLSGITGTADLVVSQVVHGAALDVDEEGTEGAAATGIGIERTFLRIIVRVNRPFLIAVVLKDTQSIIFLGKVTNPSEA

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 47.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Serine protease inhibitor.

Function : Serine protease inhibitor.

Involvement in disease :

Subcellular location : Cytoplasmic vesicle, secretory vesicle, chromaffin granule, Secreted

Protein Families : Serpin family

Tissue Specificity :

Paythway :

Uniprot ID : A2I7N1