Recombinant Bovine viral diarrhea virus Genome polyprotein, partial

Product Description

Recombinant Bovine viral diarrhea virus Genome polyprotein, partial is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names :

Expression Region : 1-168aa

AA Sequence : MELITNELLYKTYKQKPVGVEEPVYDQAGNPLFGERGAIHPQSTLKLPHKRGERNVPTSLASLPKRGDCRSGNSKGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYICIDGCITVKSATRSHQRVLRWVHNRLDCPLWVTSC

Sequence Info : Partial

Tag Info : N-terminal 10xHis-tagged

Theoretical MW : 25.0 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Initial binding to target cell probably involves interaction of E with glycosaminoglycans. E1 and/or E2 are responsible of cell attachment with CD46 and subsequent fusion after internalization of the virion by endocytosis.P7 forms a leader sequence to properly orient NS2 in the membrane.Uncleaved NS2-3 is required for production of infectious virus.NS2 protease seems to play a vital role in viral RNA replication control and in the pathogenicity of the virus.NS3 displays three enzymatic activities: serine protease, NTPase and RNA helicase.NS4A is a cofactor for the NS3 protease activity.RNA-directed RNA polymerase NS5 replicates the viral (+) and (-) genome.

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q01499