Product Description
Recombinant Callithrix jacchus Interleukin-10 (IL10) is available at Gentaur for Next week Delivery.
Gene Name: IL10
Alternative Names : Cytokine synthesis inhibitory factor;CSIF
Expression Region : 19-178aa
AA Sequence : SPGQGTQSENSCTHFPGSLPHMLRELRVAFSRVKTFFQKKDQLDSMLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGEKLKTFRLRLRRCHRFLPCENKSKAVVQVKNAVSKLQEKGIYKAMSEFDIFIDYIEAYMTMKAQN
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 20.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Function : Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Involvement in disease :
Subcellular location : Secreted
Protein Families : IL-10 family
Tissue Specificity :
Paythway :
Uniprot ID : Q0Z972
Euro
British Pound
US Dollar