Recombinant Cat Serum amyloid A protein (SAA1), partial

Product Description

Recombinant Cat Serum amyloid A protein (SAA1), partial is available at Gentaur for Next week Delivery.

Gene Name: SAA1

Alternative Names : Amyloid fibril protein AACurated

Expression Region : 1-90aa

AA Sequence : EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 12.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Major acute phase reactant. Apolipoprotein of the HDL complex.

Function : Major acute phase reactant. Apolipoprotein of the HDL complex.

Involvement in disease : Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function.

Subcellular location : Secreted

Protein Families : SAA family

Tissue Specificity : Expressed by the liver; secreted in plasma.

Paythway :

Uniprot ID : P19707