Product Description
Recombinant Centruroides noxius Beta-mammal toxin Cn2 is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names : Toxin II.9.2.2
Expression Region : 17-82aa
AA Sequence : KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 9.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals.
Function : Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily
Tissue Specificity : Expressed by the venom gland.
Paythway :
Uniprot ID : P01495
Euro
British Pound
US Dollar