Recombinant Centruroides suffusus Beta-mammal toxin Css4, partial

Product Description

Recombinant Centruroides suffusus Beta-mammal toxin Css4, partial is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Css IV

Expression Region : 20-85aa

AA Sequence : KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 9.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.

Function : Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily

Tissue Specificity : Expressed by the venom gland.

Paythway :

Uniprot ID : P60266