Product Description
Recombinant Centruroides suffusus Beta-mammal toxin Css4, partial is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names : Css IV
Expression Region : 20-85aa
AA Sequence : KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 9.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.
Function : Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily
Tissue Specificity : Expressed by the venom gland.
Paythway :
Uniprot ID : P60266
Euro
British Pound
US Dollar