Recombinant Chicken Anosmin-1 (ANOS1), partial

Product Description

Recombinant Chicken Anosmin-1 (ANOS1), partial is available at Gentaur for Next week Delivery.

Gene Name: ANOS1

Alternative Names : Kallmann syndrome protein homolog

Expression Region : 22-281aa

AA Sequence : SPAGPGAATARRQDEAFSTARCTSRCLSLQITRISAFFKHFQNNGSLAWCQNHKQCSKCLEPCKESWDLKKNHCQSFCEPLFPKKNYECLTSCEFLKYILSVKQGDCPAPEKASGFAAACVESCEADSECSGVKKCCSNGCGHTCQVPKNLYKGVPLKPRKELKFIELQSGDLEVKWSSKFNISIEPVIYVVQRRWNQGIHPSEDDATNWQTVAQTTDERVQLSDIRASRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDP

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 33.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be an adhesion-like molecule with anti-protease activity.

Function : May be an adhesion-like molecule with anti-protease activity.

Involvement in disease :

Subcellular location : Cell surface

Protein Families :

Tissue Specificity : Mainly expressed in neurons of the central nervous system during the second half of embryonic life. Expressed in mitral neurons of the olfactory bulbs, striatal neurons, Purkinje cells of the cerebellum, retinal neurons and neurons of the brainstem and spinal cord.

Paythway :

Uniprot ID : P33005