Recombinant Chicken (Chicken) Mitochondrial Rho GTPase 1 (RHOT1), partial

Product Description

Recombinant Chicken (Chicken) Mitochondrial Rho GTPase 1 (RHOT1), partial is available at Gentaur for Next week Delivery.

Gene Name: RHOT1

Alternative Names : MIRO-1 Alternative name(s): Ras homolog gene family member T1

Expression Region : 1-219aa

AA Sequence : MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQNDEQLYHEISQANVICIVYAVNNKNSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVECSAKNLKNRSELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFRISDQDNDGTLNDAELNFFQRICFNT

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 41 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Tags & Cell Markers

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution (By similarity).

Function : Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution (By similarity).

Involvement in disease :

Subcellular location : Mitochondrion outer membrane, Single-pass type IV membrane protein

Protein Families : Mitochondrial Rho GTPase family

Tissue Specificity :

Paythway :

Uniprot ID : Q5ZM73