Recombinant Chicken Homeobox protein engrailed-1 (EN1)

Product Description

Recombinant Chicken Homeobox protein engrailed-1 (EN1) is available at Gentaur for Next week Delivery.

Gene Name: EN1

Alternative Names : Short name:Gg-En-1 Short name:Homeobox protein en-1

Expression Region : 1-333aa

AA Sequence : MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQSLAQELSLNESRVKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKEESE

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-B2M-tagged

Theoretical MW : 48.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location : Nucleus

Protein Families : Engrailed homeobox family

Tissue Specificity :

Paythway :

Uniprot ID : Q05916