Euro
British Pound
US Dollar
Product Description
Recombinant Chicken Riboflavin-binding protein, partial is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names :
Expression Region : 18-225aa
AA Sequence : QQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLK
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 25.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Required for the transport of riboflavin to the developing oocyte.
Function : Required for the transport of riboflavin to the developing oocyte.
Involvement in disease :
Subcellular location :
Protein Families : Folate receptor family
Tissue Specificity : Yolk RBP is synthesized in the liver; egg-white RBP is synthesized in the oviduct.
Paythway :
Uniprot ID : P02752
