Recombinant Chicken Transforming growth factor beta-1 (TGFB1), partial

Product Description

Recombinant Chicken Transforming growth factor beta-1 (TGFB1), partial is available at Gentaur for Next week Delivery.

Gene Name: TGFB1

Alternative Names :

Expression Region : 260-373aa

AA Sequence : DLDTDYCFGPGTDEKNCCVRPLYIDFRKDLQWKWIHEPKGYMANFCMGPCPYIWSADTQYTKVLALYNQHNPGASAAPCCVPQTLDPLPIIYYVGRNVRVEQLSNMVVRACKCS

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 29 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of th have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone rodeling. It is a potent stimulator of osteoblastic bone formation, causing chotaxis, proliferation and differentiation in committed osteoblasts .

Function : Multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodeling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts. Mediates SMAD2/3 activation by inducing its phosphorylation and subsequent translocation to the nucleus (By similarity).

Involvement in disease :

Subcellular location : Secreted

Protein Families : TGF-beta family

Tissue Specificity :

Paythway :

Uniprot ID : P09531