Recombinant Chikungunya virus Non-structural polyprotein, partial

Product Description

Recombinant Chikungunya virus Non-structural polyprotein, partial is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Polyprotein nsP1234

Expression Region : 2228-2474aa

AA Sequence : DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 31.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function : P123 is short-lived polyproteins, accumulating during early stage of infection. It localizes the viral replication complex to the cytoplasmic surface of modified endosomes and lysosomes. By interacting with nsP4, it starts viral genome replication into antigenome. After these early events, P123 is cleaved sequentially into nsP1, nsP2 and nsP3. This sequence of delayed processing would allow correct assembly and membrane association of the RNA polymerase complex (By similarity).

Involvement in disease :

Subcellular location : Non-structural polyprotein: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Note=Located on the cytoplasmic surface of modified endosomes and lysosomes, also called cytopathic vacuoles type I (CPVI), These vacuoles contain numerous small circular invaginations (spherules) which may be the sites of RNA synthesis, SUBCELLULAR LOCATION: P123: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, SUBCELLULAR LOCATION: mRNA-capping enzyme nsP1: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Host cell membrane, Peripheral membrane protein, Cytoplasmic side, Note=In the late phase of infection, the polyprotein is quickly cleaved before localization to cellular membranes, Then a fraction of nsP1 localizes to the inner surface of the plasma membrane and its filopodial extensions (By similarity), SUBCELLULAR LOCATION: Protease nsP2: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Host nucleus, Note=In the late phase of infection, the polyprotein is quickly cleaved before localization to cellular membranes, Then approximately half of nsP2 is found in the nucleus (By similarity), SUBCELLULAR LOCATION: Non-structural protein 3: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Host cytoplasm

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q8JUX6