Euro
British Pound
US Dollar
Product Description
Recombinant Chironex fleckeri Toxin CfTx-1, partial is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names :
Expression Region : 145-456aa
AA Sequence : EQSDQELQEALYGVKREYAVSKAFLDGVRNETSDLSPTEVSALAANVPIYQGVRFIAMVVQRIKYIKPKTESEIKRMLTMLELFTDLCSLRDLILLDLYQLVATPGHSPNIASGIKEVSNLGREEYKKVFEDLLKNDDKETYLFLSYLYPREKNEQSRKIFNFFDLMKVKYDDRLKQDLTGVKIFSNVHWPNYFMCSSNDYLALICTKPYGSLKLDKLNDGYYSIKTTQHDPKICHRYGNYILFTHKRNDDLEKFNFVPVKLEKREIYLLSSKESPNKFAYVPQNADGALFFVDGIPSKVGYGNQGYFTLVE
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 52.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Has potent hemolytic activity. Is lethal to crayfish. Causes cutaneous inflammation in humans. May act as a pore-forming toxin, disrupting normal transmembrane ion concentration gradients in susceptible cells
Function : Has potent hemolytic activity. Is lethal to crayfish. Causes cutaneous inflammation in humans. May act as a pore-forming toxin, disrupting normal transmembrane ion concentration gradients in susceptible cells (By similarity).
Involvement in disease :
Subcellular location : Secreted, Nematocyst, Target cell membrane
Protein Families : Jellyfish toxin family
Tissue Specificity :
Paythway :
Uniprot ID : A7L035
