Recombinant Clostridium acetobutylicum Butyrate--acetoacetate CoA-transferase subunit B (ctfB)

Product Description

Recombinant Clostridium acetobutylicum Butyrate--acetoacetate CoA-transferase subunit B (ctfB) is available at Gentaur for Next week Delivery.

Gene Name: ctfB

Alternative Names : Acetoacetyl-CoA:acetate/butyrate CoA-transferase subunit B (Coat B)

Expression Region : 1-221aa

AA Sequence : MINDKNLAKEIIAKRVARELKNGQLVNLGVGLPTMVADYIPKNFKITFQSENGIVGMGASPKINEADKDVVNAGGDYTTVLPDGTFFDSSVSFSLIRGGHVDVTVLGALQVDEKGNIANWIVPGKMLSGMGGAMDLVNGAKKVIIAMRHTNKGQPKILKKCTLPLTAKSQANLIVTELGVIEVINDGLLLTEINKNTTIDEIRSLTAADLLISNELRPMAV

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 30.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in solventogenic switch which allows C.acetobutylicum to uptake acid and produce solvents. Acts mainly to detoxify the medium by removing the acetate and butyrate excreted earlier in the fermentation.

Function : Involved in solventogenic switch which allows C.acetobutylicum to uptake acid and produce solvents. Acts mainly to detoxify the medium by removing the acetate and butyrate excreted earlier in the fermentation.

Involvement in disease :

Subcellular location :

Protein Families : 3-oxoacid CoA-transferase subunit B family

Tissue Specificity :

Paythway :

Uniprot ID : P23673