Recombinant Clostridium botulinum Penicillin-binding protein 1A (pbpA), partial

Product Description

Recombinant Clostridium botulinum Penicillin-binding protein 1A (pbpA), partial is available at Gentaur for Next week Delivery.

Gene Name: pbpA

Alternative Names : Peptidoglycan TGase DD-transpeptidase

Expression Region : 663-830aa

AA Sequence : VDRISGKLPTQLSYRDPRGSTVYNEFFINGTIPTEYDDIHVEAQINKLTGKLASKFTPSFLVESRVFLRRDYSPGVELLDQQWLLPYSIDEGGSLPPTEEKNNSNTRDKNKDKNKNKNKDKNPSQDKPNNNNNDNNSNNNNNNNDNNNNTKPPENDSNQNHEDNKNKQ

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 35.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).

Function : Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type II membrane protein

Protein Families : Glycosyltransferase 51 family; Transpeptidase family

Tissue Specificity :

Paythway :

Uniprot ID : A5I6G4