Recombinant Coptis japonica S-norcoclaurine synthase 2 (PR10A)

Product Description

Recombinant Coptis japonica S-norcoclaurine synthase 2 (PR10A) is available at Gentaur for Next week Delivery.

Gene Name: PR10A

Alternative Names : Pathogenesis related protein 10A;CjPR10A

Expression Region : 20-196aa

AA Sequence : ERLIFNGRPLLHRVTKEETVMLYHELEVAASADEVWSVEGSPELGLHLPDLLPAGIFAKFEITGDGGEGSILDMTFPPGQFPHHYREKFVFFDHKNRYKLVEQIDGDFFDLGVTYYMDTIRVVATGPDSCVIKSTTEYHVKPEFAKIVKPLIDTVPLAIMSEAIAKVVLENKHKSSE

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 36 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the biosynthesis of the common precursor of all benzylisoquinoline alkaloids such as morphine, sanguinarine, codeine or berberine. Condenses dopamine and pyruvic acid or 4-hydroxyphenylpyruvate.

Function : Involved in the biosynthesis of the common precursor of all benzylisoquinoline alkaloids such as morphine, sanguinarine, codeine or berberine. Condenses dopamine and pyruvic acid or 4-hydroxyphenylpyruvate.

Involvement in disease :

Subcellular location :

Protein Families : BetVI family

Tissue Specificity :

Paythway :

Uniprot ID : A2A1A1