Recombinant Cupressus arizonica Pectate lyase 1

Product Description

Recombinant Cupressus arizonica Pectate lyase 1 is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Major pollen allergen Cup a 1 Allergen: Cup a 1

Expression Region : 22-367aa

AA Sequence : ADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Theoretical MW : 65.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Allergen

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Has pectate lyase activity.

Function : Has pectate lyase activity.

Involvement in disease :

Subcellular location :

Protein Families : Polysaccharide lyase 1 family, Amb a subfamily

Tissue Specificity :

Paythway :

Uniprot ID : Q9SCG9