Product Description
Recombinant Cyprinus carpio Granulin-3 is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names :
Expression Region : 1-57aa
AA Sequence : VVFCDAGITCPSGTTCCRSPFGVWYCCPFLMGQCCRDGRHCCRHGYHCDSTSTLCLR
Sequence Info : Full Length
Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 13.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Granulins have possible cytokine-like activity. They may play a role in inflammation, wound repair, and tissue remodeling.
Function : Granulins have possible cytokine-like activity. They may play a role in inflammation, wound repair, and tissue remodeling.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Granulin family
Tissue Specificity : Ubiquitous.
Paythway :
Uniprot ID : P81015
Euro
British Pound
US Dollar