Recombinant Dahlia merckii Defensin-like protein 1

Product Description

Recombinant Dahlia merckii Defensin-like protein 1 is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Cysteine-rich antimicrobial protein 1 Defensin AMP1

Expression Region : 1-50aa

AA Sequence : ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-B2M-tagged

Theoretical MW : 19.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes.

Function : Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca(2+) uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes.

Involvement in disease :

Subcellular location : Secreted

Protein Families : DEFL family

Tissue Specificity :

Paythway :

Uniprot ID : P0C8Y4