Euro
British Pound
US Dollar
Product Description
Recombinant Danio rerio Metallothionein-1 (mt) is available at Gentaur for Next week Delivery.
Gene Name: mt
Alternative Names :
Expression Region : 1-60aa
AA Sequence : MDPCECAKTGACNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGTSCCQ
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 22 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Metallothioneins have a high content of cysteine residues that bind various heavy metals.
Function : Metallothioneins have a high content of cysteine residues that bind various heavy metals.
Involvement in disease :
Subcellular location :
Protein Families : Metallothionein superfamily, Type 1 family
Tissue Specificity :
Paythway :
Uniprot ID : P52722
![Recombinant Danio rerio Superoxide dismutase [Cu-Zn] (sod1)](https://cdn11.bigcommerce.com/s-xsxw42fzca/images/stencil/500x659/products/2625/4787/biomatik__62975.1619617016__80998.1619624007.png?c=1 "Recombinant Danio rerio Superoxide dismutase [Cu-Zn] (sod1)")
