Recombinant Danio rerio Superoxide dismutase [Cu-Zn] (sod1)

Product Description

Recombinant Danio rerio Superoxide dismutase [Cu-Zn] (sod1) is available at Gentaur for Next week Delivery.

Gene Name: sod1

Alternative Names :

Expression Region : 1-154aa

AA Sequence : MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 37.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Destroys radicals which are normally produced within the cells and which are toxic to biological systems.

Function : Destroys radicals which are normally produced within the cells and which are toxic to biological systems.

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus

Protein Families : Cu-Zn superoxide dismutase family

Tissue Specificity :

Paythway :

Uniprot ID : O73872