Euro
British Pound
US Dollar
Product Description
Recombinant Danio rerio Tumor necrosis factor (TNF superfamily, member 2) (tnfb), partial is available at Gentaur for Next week Delivery.
Gene Name: tnfb
Alternative Names : tnf TNF alpha
Expression Region : 101-242aa
AA Sequence : AIHLHGDPSGQSLKWVGGVDQAFQQGGLRLENNEIIIPKDGLYFVYSQVSYETLCVEDVEGDGQKYLSHTINRYTDAVREKMPLQNSANSVCQSLDGKTSYSTIYLGAVFDLFGDDRLSTHTTRVGDIENNYAKTFFGVFAL
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 19.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : Q4W898
