Recombinant Danio rerio von Willebrand factor C domain-containing protein 2-like (vwc2l)

Product Description

Recombinant Danio rerio von Willebrand factor C domain-containing protein 2-like (vwc2l) is available at Gentaur for Next week Delivery.

Gene Name: vwc2l

Alternative Names :

Expression Region : 22-223aa

AA Sequence : ASVGPEDYPAADEAERTANNDIIFDDYRGKGCVDDSGFVYKLGERFFPGHSNCPCVCTEDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYRGKTYKILEEFKPSPCEWCRCEPNNEVHCVVADCAVPECVNPVYEPEQCCPICKNGPNCFAGTTIIPAGIEVKVDDCTICRCHSGDWWKPAQCLRRECLNGQATS

Sequence Info : Full Length of Mature Protein

Tag Info : C-terminal 6xHis-Myc-tagged

Theoretical MW : 25.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play a role in bone differentiation and matrix mineralization. May play a role in neural development.

Function : May play a role in bone differentiation and matrix mineralization (By similarity). May play a role in neural development.

Involvement in disease :

Subcellular location : Secreted, Cell junction, synapse

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : B0UZC8