Product Description
Recombinant Dendroaspis polylepis polylepis Toxin MIT1 is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names : Short name: MIT 1 Alternative name(s): Black mamba intestinal toxin 1 Black mamba venom protein A
Expression Region : 1-81aa
AA Sequence : AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 24.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Potently contracts gastrointestinal (GI) smooth muscle. The receptor for this toxin is present both in the CNS and in the smooth muscle and may be a potassium channel.
Function : Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2
Involvement in disease :
Subcellular location : Secreted
Protein Families : AVIT (prokineticin) family
Tissue Specificity : Expressed by the venom gland.
Paythway :
Uniprot ID : P25687
Euro
British Pound
US Dollar