Recombinant Dendroaspis polylepis polylepis Toxin MIT1

Product Description

Recombinant Dendroaspis polylepis polylepis Toxin MIT1 is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Short name: MIT 1 Alternative name(s): Black mamba intestinal toxin 1 Black mamba venom protein A

Expression Region : 1-81aa

AA Sequence : AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 24.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Potently contracts gastrointestinal (GI) smooth muscle. The receptor for this toxin is present both in the CNS and in the smooth muscle and may be a potassium channel.

Function : Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2

Involvement in disease :

Subcellular location : Secreted

Protein Families : AVIT (prokineticin) family

Tissue Specificity : Expressed by the venom gland.

Paythway :

Uniprot ID : P25687