Euro
British Pound
US Dollar
Product Description
Recombinant Dermatophagoides farinae Mite group 2 allergen Der f 2 (DERF2) is available at Gentaur for Next week Delivery.
Gene Name: DERF2
Alternative Names : Allergen Der f II Allergen: Der f 2
Expression Region : 18-146aa
AA Sequence : DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 16.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Secreted
Protein Families : NPC2 family
Tissue Specificity :
Paythway :
Uniprot ID : Q00855
