Recombinant Dictyostelium discoideum Ponticulin (ponA)

Product Description

Recombinant Dictyostelium discoideum Ponticulin (ponA) is available at Gentaur for Next week Delivery.

Gene Name: ponA

Alternative Names :

Expression Region : 23-118aa

AA Sequence : QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 11.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds F-actin and nucleates actin assembly. Major high affinity link between the plasma membrane and the cortical actin network.

Function : Binds F-actin and nucleates actin assembly. Major high affinity link between the plasma membrane and the cortical actin network.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein, Cell membrane, Lipid-anchor, GPI-anchor

Protein Families : Ponticulin family

Tissue Specificity :

Paythway :

Uniprot ID : P54660