Product Description
Recombinant Dog Calcitonin (CALCA), partial is available at Gentaur for Next week Delivery.
Gene Name: CALCA
Alternative Names :
Expression Region : 85-116aa
AA Sequence : CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 19.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
Function : Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Calcitonin family
Tissue Specificity : Synthesized by C-cells of the thyroid gland.
Paythway :
Uniprot ID : P41547
Euro
British Pound
US Dollar