Recombinant Dog Calcitonin (CALCA), partial

Product Description

Recombinant Dog Calcitonin (CALCA), partial is available at Gentaur for Next week Delivery.

Gene Name: CALCA

Alternative Names :

Expression Region : 85-116aa

AA Sequence : CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 19.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.

Function : Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Calcitonin family

Tissue Specificity : Synthesized by C-cells of the thyroid gland.

Paythway :

Uniprot ID : P41547