Product Description
Recombinant Dog Cholinesterase (BCHE) is available at Gentaur for Next week Delivery.
Gene Name: BCHE
Alternative Names : Acylcholine acylhydrolaseButyrylcholine esteraseCholine esterase IIPseudocholinesterase
Expression Region : 1-141aa
AA Sequence : NTDQSFPGFPGSEMWNPNTDLSEDCLYLNVWIPTPKPKNATVMIWIYGGGFQTGTSSLPVYDGKFLARVERVIVVSVNYRVGALGFLALPGNPEAPGNLGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAGSVGLHL
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 17.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters .
Function : Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters (By similarity).
Involvement in disease :
Subcellular location : Secreted
Protein Families : Type-B carboxylesterase/lipase family
Tissue Specificity : Present in most cells except erythrocytes.
Paythway :
Uniprot ID : P32750