Recombinant Dog Tight junction protein ZO-1 (TJP1), partial

Product Description

Recombinant Dog Tight junction protein ZO-1 (TJP1), partial is available at Gentaur for Next week Delivery.

Gene Name: TJP1

Alternative Names : Tight junction protein 1Zona occludens protein 1Zonula occludens protein 1

Expression Region : 1633-1769aa

AA Sequence : VVATARGVFNNNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGANCVSVLIDHF

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 18.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : The N-terminal may be involved in transducing a signal required for tight junction assbly, while the C-terminal may have specific properties of tight junctions. The alpha domain might be involved in stabilizing junctions. Plays a role in the regulation of cell migration by targeting CDC42BPB to the leading edge of migrating cells .

Function : TJP1, TJP2, and TJP3 are closely related scaffolding proteins that link tight junction (TJ) transmembrane proteins such as claudins, junctional adhesion molecules, and occludin to the actin cytoskeleton

Involvement in disease :

Subcellular location : Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cell junction, tight junction, Cell junction, Cell junction, gap junction

Protein Families : MAGUK family

Tissue Specificity :

Paythway :

Uniprot ID : O97758