Recombinant Drosophila melanogaster Ubiquitin-conjugating enzyme E2-17KDA (UbcD6)

Product Description

Recombinant Drosophila melanogaster Ubiquitin-conjugating enzyme E2-17KDA (UbcD6) is available at Gentaur for Next week Delivery.

Gene Name: UbcD6

Alternative Names : Ubiquitin carrier proteinUbiquitin-protein ligase

Expression Region : 1-151aa

AA Sequence : MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 19.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the covalent attachment of ubiquitin to other proteins. Required for postreplication repair of UV-damaged DNA.

Function : Catalyzes the covalent attachment of ubiquitin to other proteins. Required for postreplication repair of UV-damaged DNA

Involvement in disease :

Subcellular location : Nucleus

Protein Families : Ubiquitin-conjugating enzyme family

Tissue Specificity :

Paythway :

Uniprot ID : P25153