Product Description
Recombinant Entamoeba histolytica Multidrug resistance protein 1 (MDR1) is available at Gentaur for Next week Delivery.
Gene Name: MDR1
Alternative Names : P-glycoprotein
Expression Region : 1-114aa
AA Sequence : SGCGKSTTIQLIQRNYEPNGGRVTLDGKDIRELNIKWLRNQIGLVGQEPVLFAGTIRENIMLGAKEGETLSKDEMIECAKMANAHEFVSKLAEGYDTLIGEKGALLSGGQRQRI
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 14.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
Function : Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
Involvement in disease :
Subcellular location : Membrane, Multi-pass membrane protein
Protein Families : ABC transporter superfamily, ABCB family, Multidrug resistance exporter (TC 3.A.1.201) subfamily
Tissue Specificity :
Paythway :
Uniprot ID : P16875