Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2)

Product Description

Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2) is available at Gentaur for Next week Delivery.

Gene Name: stxB2

Alternative Names : Verocytotoxin 2 subunit B;Verotoxin 2 subunit B

Expression Region : 20-89aa

AA Sequence : ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 9.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.

Function : The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.

Involvement in disease :

Subcellular location : Secreted

Protein Families : StxB family

Tissue Specificity :

Paythway :

Uniprot ID : P09386