Product Description
Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB) is available at Gentaur for Next week Delivery.
Gene Name: stxB
Alternative Names : Verocytotoxin 1 subunit B;Verotoxin 1 subunit B
Expression Region : 21-89aa
AA Sequence : TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 9.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
Function : The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
Involvement in disease :
Subcellular location : Secreted
Protein Families : StxB family
Tissue Specificity :
Paythway :
Uniprot ID : P69179
Euro
British Pound
US Dollar